Lineage for d1f1ma_ (1f1m A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies) 
Superfamily a.24.12: Outer surface protein C (OspC) [63515] (1 family) 
Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein) Protein Outer surface protein C (OspC) [63517] (1 species) Species Lyme disease spirochete (Borrelia burgdorferi), different strains? [63518] (3 PDB entries) 
Domain d1f1ma_: 1f1m A: [59598]
Details for d1f1ma_
PDB Entry: 1f1m (more details), 1.8 Å
PDB Description: crystal structure of outer surface protein c (ospc)
SCOP Domain Sequences for d1f1ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1ma_ a.24.12.1 (A:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains?}
pnlteiskkitesnavvlavkevetlltsidelakaigkkiksdvsldneadhngslmsg
aylistlitkkisaikdsgelkaeiekakkcseeftaklkgehtdlgkegvtddnakkai
lktnndktkgadeleklfesvknlskaakemltnsvkeltsp
SCOP Domain Coordinates for d1f1ma_:
Click to download the PDB-style file with coordinates for d1f1ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f1ma_:
- d1f1ma_ first appeared in SCOP 1.57
- d1f1ma_ appears in SCOP 1.61
- d1f1ma_ appears in the current release, SCOPe 2.08
View in 3D
