Lineage for d1f1hl2 (1f1h L:101-468)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974759Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins)
  6. 2974760Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 2974810Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 2974834Domain d1f1hl2: 1f1h L:101-468 [59595]
    Other proteins in same PDB: d1f1ha1, d1f1hb1, d1f1hc1, d1f1hd1, d1f1he1, d1f1hf1, d1f1hg1, d1f1hh1, d1f1hi1, d1f1hj1, d1f1hk1, d1f1hl1
    complexed with adp, mn, mpd, tl

Details for d1f1hl2

PDB Entry: 1f1h (more details), 2.67 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions
PDB Compounds: (L:) protein (glutamine synthetase)

SCOPe Domain Sequences for d1f1hl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1hl2 d.128.1.1 (L:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOPe Domain Coordinates for d1f1hl2:

Click to download the PDB-style file with coordinates for d1f1hl2.
(The format of our PDB-style files is described here.)

Timeline for d1f1hl2: