![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
![]() | Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
![]() | Domain d1f1hk1: 1f1h K:1-100 [59592] Other proteins in same PDB: d1f1ha2, d1f1hb2, d1f1hc2, d1f1hd2, d1f1he2, d1f1hf2, d1f1hg2, d1f1hh2, d1f1hi2, d1f1hj2, d1f1hk2, d1f1hl2 complexed with adp, mn, mpd, tl |
PDB Entry: 1f1h (more details), 2.67 Å
SCOPe Domain Sequences for d1f1hk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1hk1 d.15.9.1 (K:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
Timeline for d1f1hk1: