SCOP 1.57: Domain d1f1hi1: 1f1h I:1-100

Lineage for d1f1hi1 (1f1h I:1-100)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d1f1hi1: 1f1h I:1-100 [59588]
   Other proteins in same PDB: d1f1ha2, d1f1hb2, d1f1hc2, d1f1hd2, d1f1he2, d1f1hf2, d1f1hg2, d1f1hh2, d1f1hi2, d1f1hj2, d1f1hk2, d1f1hl2

Details for d1f1hi1

PDB Entry: 1f1h, 2.67 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions

SCOP Domain Sequences for d1f1hi1:

Sequence; same for both SEQRES and ATOM records:

>d1f1hi1 d.15.9.1 (I:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Timeline for d1f1hi1:

• d1f1hi1 is new in SCOP 1.57
  
• d1f1hi1 appears in SCOP 1.59
  
• d1f1hi1 appears in the current release, SCOPe 2.08