![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins) |
![]() | Protein Glutamine synthetase, C-terminal domain [55933] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries) |
![]() | Domain d1f1hd2: 1f1h D:101-468 [59579] Other proteins in same PDB: d1f1ha1, d1f1hb1, d1f1hc1, d1f1hd1, d1f1he1, d1f1hf1, d1f1hg1, d1f1hh1, d1f1hi1, d1f1hj1, d1f1hk1, d1f1hl1 complexed with adp, mn, mpd, tl |
PDB Entry: 1f1h (more details), 2.67 Å
SCOPe Domain Sequences for d1f1hd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1hd2 d.128.1.1 (D:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv efelyysv
Timeline for d1f1hd2: