Lineage for d1f1hd1 (1f1h D:1-100)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131361Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 131362Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 131363Protein Glutamine synthetase, N-terminal domain [54370] (1 species)
  7. 131364Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 131380Domain d1f1hd1: 1f1h D:1-100 [59578]
    Other proteins in same PDB: d1f1ha2, d1f1hb2, d1f1hc2, d1f1hd2, d1f1he2, d1f1hf2, d1f1hg2, d1f1hh2, d1f1hi2, d1f1hj2, d1f1hk2, d1f1hl2

Details for d1f1hd1

PDB Entry: 1f1h (more details), 2.67 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions

SCOP Domain Sequences for d1f1hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1hd1 d.15.9.1 (D:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d1f1hd1:

Click to download the PDB-style file with coordinates for d1f1hd1.
(The format of our PDB-style files is described here.)

Timeline for d1f1hd1: