SCOP 1.57: Domain d1f1cb_: 1f1c B:

Lineage for d1f1cb_ (1f1c B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (5 families)

5. Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)

6. Protein Photosystem II associated cytochrome c549 [63459] (2 species)

7. Species Arthrospira maxima [TaxId:129910] [63461] (1 PDB entry)

8. Domain d1f1cb_: 1f1c B: [59570]

Details for d1f1cb_

PDB Entry: 1f1c, 2.3 Å

PDB Description: crystal structure of cytochrome c549

SCOP Domain Sequences for d1f1cb_:

Sequence; same for both SEQRES and ATOM records:

>d1f1cb_ a.3.1.1 (B:) Photosystem II associated cytochrome c549 {Arthrospira maxima}
lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
pkvrgeqwg

Timeline for d1f1cb_:

• d1f1cb_ is new in SCOP 1.57
  
• d1f1cb_ appears in SCOP 1.59
  
• d1f1cb_ appears in the current release, SCOPe 2.08