Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1f1cb_ (1f1c B:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. Protein Photosystem II associated cytochrome c549 [63459] (2 species)
  7. Species Arthrospira maxima [TaxId:129910] [63461] (1 PDB entry)
  8. Domain d1f1cb_: 1f1c B: [59570]
    complexed with hem

Details for d1f1cb_

PDB Entry: 1f1c (more details)
PDB Description: crystal structure of cytochrome c549
PDB Compounds: (B:) cytochrome c549

SCOP Domain Sequences for d1f1cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1cb_ a.3.1.1 (B:) Photosystem II associated cytochrome c549 {Arthrospira maxima [TaxId: 129910]}
lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
pkvrgeqwg

SCOP Domain Coordinates for d1f1cb_:

Click to download the PDB-style file with coordinates for d1f1cb_.
(The format of our PDB-style files is described here.)

Timeline for d1f1cb_:

d1f1cb_ appears in SCOP 1.75A


d1f1cb_
(click for larger image)


d1f1cb_ in context of chain



d1f1cb_ in context of PDB
Domains from other chains:
d1f1ca_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu