Lineage for d1f0qa_ (1f0q A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220398Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2220534Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries)
  8. 2220568Domain d1f0qa_: 1f0q A: [59568]
    complexed with emo

Details for d1f0qa_

PDB Entry: 1f0q (more details), 2.63 Å

PDB Description: crystal structure of the alpha subunit of protein kinase ck2 in complex with the nucleotide competitive inhibitor emodin
PDB Compounds: (A:) protein kinase ck2, alpha subunit

SCOPe Domain Sequences for d1f0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0qa_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaensr

SCOPe Domain Coordinates for d1f0qa_:

Click to download the PDB-style file with coordinates for d1f0qa_.
(The format of our PDB-style files is described here.)

Timeline for d1f0qa_: