Lineage for d1f0ia1 (1f0i A:6-263)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927884Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 1927885Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 1927891Family d.136.1.2: Phospholipase D [64391] (1 protein)
    duplication: contains two domains of this fold arranged as in the Nuc dimer
  6. 1927892Protein Phospholipase D [64392] (1 species)
  7. 1927893Species Streptomyces sp. [TaxId:1931] [64393] (8 PDB entries)
    Uniprot P84147
  8. 1927896Domain d1f0ia1: 1f0i A:6-263 [59566]
    complexed with po4

Details for d1f0ia1

PDB Entry: 1f0i (more details), 1.4 Å

PDB Description: the first crystal structure of a phospholipase d
PDB Compounds: (A:) phospholipase d

SCOPe Domain Sequences for d1f0ia1:

Sequence, based on SEQRES records: (download)

>d1f0ia1 d.136.1.2 (A:6-263) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
aatphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnslkvrilvgaa
pvyhmngipskyrdkltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgg
inswkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcknksniasvwfaasgnag
cmptmhkdtnpkaspatg

Sequence, based on observed residues (ATOM records): (download)

>d1f0ia1 d.136.1.2 (A:6-263) Phospholipase D {Streptomyces sp. [TaxId: 1931]}
aatphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnslkvrilvgaa
phmngipskyrdkltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltggin
swkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcknksniasvwfaasgnagcm
ptmhkdtnpkaspatg

SCOPe Domain Coordinates for d1f0ia1:

Click to download the PDB-style file with coordinates for d1f0ia1.
(The format of our PDB-style files is described here.)

Timeline for d1f0ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f0ia2