Lineage for d1f08b_ (1f08 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607407Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 607408Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) (S)
  5. 607414Family d.89.1.2: Replication initiation protein E1 [64332] (1 protein)
  6. 607415Protein Replication initiation protein E1 [64333] (2 species)
  7. 607416Species Bovine papillomavirus [TaxId:10571] [64334] (3 PDB entries)
  8. 607418Domain d1f08b_: 1f08 B: [59565]
    complexed with br

Details for d1f08b_

PDB Entry: 1f08 (more details), 1.9 Å

PDB Description: crystal structure of the dna-binding domain of the replication initiation protein e1 from papillomavirus

SCOP Domain Sequences for d1f08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f08b_ d.89.1.2 (B:) Replication initiation protein E1 {Bovine papillomavirus}
atvfklglfkslflcsfhditrlfkndkttnqqwvlavfglaevffeasfellkkqcsfl
qmqkrsheggtcavylicfntaksretvrnlmanmlnvreeclmlqppkirglsaalfwf
ksslspatlkhgalpewiraqttln

SCOP Domain Coordinates for d1f08b_:

Click to download the PDB-style file with coordinates for d1f08b_.
(The format of our PDB-style files is described here.)

Timeline for d1f08b_: