Lineage for d1f07b_ (1f07 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448077Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2448114Family c.1.16.3: F420 dependent oxidoreductases [51687] (2 proteins)
    automatically mapped to Pfam PF00296
  6. 2448118Protein Coenzyme F420 dependent tetrahydromethanopterin reductase [51688] (2 species)
  7. 2448119Species Methanobacterium thermoautotrophicum [TaxId:145262] [63924] (1 PDB entry)
  8. 2448121Domain d1f07b_: 1f07 B: [59561]
    complexed with cl, mpd, mpo

Details for d1f07b_

PDB Entry: 1f07 (more details), 2 Å

PDB Description: structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum
PDB Compounds: (B:) coenzyme f420-dependent n5,n10-methylenetetrahydromethanopterin reductase

SCOPe Domain Sequences for d1f07b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f07b_ c.1.16.3 (B:) Coenzyme F420 dependent tetrahydromethanopterin reductase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkfgiefvpnepiekivklvklaedvgfeyawitdhynnknvyetlaliaegtetiklgp
gvtnpyvrspaitasaiatldelsngratlgigpgdkatfdalgiewvkpvstirdaiam
mrtllagektesgaqlmgvkavqekipiymgaqgpmmlktageisdgalinasnpkdfea
avplikegaeaagksiadidvaaytccsidedaaaaanaakivvafiaagspppvferhg
lpadtgkkfgellgkgdfggaigavddalmeafsvvgtpdefipkiealgemgvtqyvag
spigpdkeksikllgeviasf

SCOPe Domain Coordinates for d1f07b_:

Click to download the PDB-style file with coordinates for d1f07b_.
(The format of our PDB-style files is described here.)

Timeline for d1f07b_: