Lineage for d1f07a_ (1f07 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117763Superfamily c.1.16: Bacterial luciferase-like [51679] (3 families) (S)
  5. 117782Family c.1.16.3: Coenzyme F420 dependent tetrahydromethanopterin reductase [51687] (1 protein)
  6. 117783Protein Coenzyme F420 dependent tetrahydromethanopterin reductase [51688] (2 species)
  7. 117784Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63924] (1 PDB entry)
  8. 117785Domain d1f07a_: 1f07 A: [59560]

Details for d1f07a_

PDB Entry: 1f07 (more details), 2 Å

PDB Description: structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1f07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f07a_ c.1.16.3 (A:) Coenzyme F420 dependent tetrahydromethanopterin reductase {Archaeon Methanobacterium thermoautotrophicum}
mkfgiefvpnepiekivklvklaedvgfeyawitdhynnknvyetlaliaegtetiklgp
gvtnpyvrspaitasaiatldelsngratlgigpgdkatfdalgiewvkpvstirdaiam
mrtllagektesgaqlmgvkavqekipiymgaqgpmmlktageisdgalinasnpkdfea
avplikegaeaagksiadidvaaytccsidedaaaaanaakivvafiaagspppvferhg
lpadtgkkfgellgkgdfggaigavddalmeafsvvgtpdefipkiealgemgvtqyvag
spigpdkeksikllgeviasf

SCOP Domain Coordinates for d1f07a_:

Click to download the PDB-style file with coordinates for d1f07a_.
(The format of our PDB-style files is described here.)

Timeline for d1f07a_: