![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) ![]() consists of clearly related families of somewhat different folds |
![]() | Family c.1.16.3: F420 dependent oxidoreductases [51687] (2 proteins) automatically mapped to Pfam PF00296 |
![]() | Protein Coenzyme F420 dependent tetrahydromethanopterin reductase [51688] (2 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [63924] (1 PDB entry) |
![]() | Domain d1f07a_: 1f07 A: [59560] complexed with cl, mpd, mpo |
PDB Entry: 1f07 (more details), 2 Å
SCOPe Domain Sequences for d1f07a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f07a_ c.1.16.3 (A:) Coenzyme F420 dependent tetrahydromethanopterin reductase {Methanobacterium thermoautotrophicum [TaxId: 145262]} mkfgiefvpnepiekivklvklaedvgfeyawitdhynnknvyetlaliaegtetiklgp gvtnpyvrspaitasaiatldelsngratlgigpgdkatfdalgiewvkpvstirdaiam mrtllagektesgaqlmgvkavqekipiymgaqgpmmlktageisdgalinasnpkdfea avplikegaeaagksiadidvaaytccsidedaaaaanaakivvafiaagspppvferhg lpadtgkkfgellgkgdfggaigavddalmeafsvvgtpdefipkiealgemgvtqyvag spigpdkeksikllgeviasf
Timeline for d1f07a_: