Lineage for d1f06b1 (1f06 B:501-618,B:769-820)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828754Protein Diaminopimelic acid dehydrogenase (DAPDH) [51819] (1 species)
  7. 1828755Species Corynebacterium glutamicum [TaxId:1718] [51820] (4 PDB entries)
  8. 1828757Domain d1f06b1: 1f06 B:501-618,B:769-820 [59558]
    Other proteins in same PDB: d1f06a2, d1f06b2
    complexed with 2np, ndp

Details for d1f06b1

PDB Entry: 1f06 (more details), 2.1 Å

PDB Description: three dimensional structure of the ternary complex of corynebacterium glutamicum diaminopimelate dehydrogenase nadph-l-2-amino-6-methylene- pimelate
PDB Compounds: (B:) meso-diaminopimelate d-dehydrogenase

SCOPe Domain Sequences for d1f06b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f06b1 c.2.1.3 (B:501-618,B:769-820) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}
mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd
vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgXr
npdftassqiafgraahrmkqqgqsgaftvlevapyllspenlddliardv

SCOPe Domain Coordinates for d1f06b1:

Click to download the PDB-style file with coordinates for d1f06b1.
(The format of our PDB-style files is described here.)

Timeline for d1f06b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f06b2