SCOPe 2.04: Domain d1f06a1: 1f06 A:1-118,A:269-320

Lineage for d1f06a1 (1f06 A:1-118,A:269-320)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Diaminopimelic acid dehydrogenase (DAPDH) [51819] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [51820] (4 PDB entries)

8. Domain d1f06a1: 1f06 A:1-118,A:269-320 [59556]
   Other proteins in same PDB: d1f06a2, d1f06b2
   complexed with 2np, ndp

Details for d1f06a1

PDB Entry: 1f06, 2.1 Å

PDB Description: three dimensional structure of the ternary complex of corynebacterium glutamicum diaminopimelate dehydrogenase nadph-l-2-amino-6-methylene- pimelate

PDB Compounds: (A:) meso-diaminopimelate d-dehydrogenase

SCOPe Domain Sequences for d1f06a1:

Sequence; same for both SEQRES and ATOM records:

>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}
mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd
vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgXr
npdftassqiafgraahrmkqqgqsgaftvlevapyllspenlddliardv

Timeline for d1f06a1:

• d1f06a1 first appeared in SCOP 1.57
  
• d1f06a1 appears in SCOPe 2.03
  
• d1f06a1 appears in SCOPe 2.05
  
• d1f06a1 appears in the current release, SCOPe 2.08