![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain [63641] (3 PDB entries) |
![]() | Domain d1ezvy_: 1ezv Y: [59555] Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_ complexed with fes, hem, sma, uq6 |
PDB Entry: 1ezv (more details), 2.3 Å
SCOP Domain Sequences for d1ezvy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezvy_ b.1.1.1 (Y:) Immunoglobulin (variable domains of L and H chains) {Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain} dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik
Timeline for d1ezvy_: