| Class b: All beta proteins [48724] (110 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
| Species Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain [63641] (1 PDB entry) |
| Domain d1ezvy_: 1ezv Y: [59555] Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc1, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf1, d1ezvg1, d1ezvh1, d1ezvi1 |
PDB Entry: 1ezv (more details), 2.3 Å
SCOP Domain Sequences for d1ezvy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezvy_ b.1.1.1 (Y:) Immunoglobulin (variable domains of L and H chains) {Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain}
dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik
Timeline for d1ezvy_: