Details for d1ezvi_

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvi_ f.23.14.1 (I:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOP Domain Coordinates for d1ezvi_:

Click to download the PDB-style file with coordinates for d1ezvi_.
(The format of our PDB-style files is described here.)

Timeline for d1ezvi_: