SCOP 1.63: Domain d1ezvi_: 1ezv I:

Lineage for d1ezvi_ (1ezv I:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)

6. Protein Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   inteacts with cytochrome c1 and ISP

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (3 PDB entries)

8. Domain d1ezvi_: 1ezv I: [59553]
   Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvx_, d1ezvy_
   complexed with fes, hem, sma, uq6

Details for d1ezvi_

PDB Entry: 1ezv, 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvi_:

Sequence; same for both SEQRES and ATOM records:

>d1ezvi_ f.23.14.1 (I:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

Timeline for d1ezvi_:

• d1ezvi_ first appeared in SCOP 1.57, called d1ezvi1
  
• d1ezvi_ was called d1ezvi1 in SCOP 1.61
  
• d1ezvi_ appears in SCOP 1.65
  
• d1ezvi_ appears in the current release, SCOPe 2.08