![]() | Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() |
![]() | Family f.23.14.1: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein) |
![]() | Protein Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) inteacts with cytochrome c1 and ISP |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (3 PDB entries) |
![]() | Domain d1ezvi_: 1ezv I: [59553] Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvx_, d1ezvy_ complexed with fes, hem, sma, uq6 |
PDB Entry: 1ezv (more details), 2.3 Å
SCOP Domain Sequences for d1ezvi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezvi_ f.23.14.1 (I:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)} sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
Timeline for d1ezvi_: