Lineage for d1ezvf_ (1ezv F:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746353Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 746354Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 746355Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 746356Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 746357Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81521] (5 PDB entries)
  8. 746360Domain d1ezvf_: 1ezv F: [59550]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_
    complexed with fes, hem, sma, uq6

Details for d1ezvf_

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
PDB Compounds: (F:) ubiquinol-cytochrome c reductase complex 14 kd protein

SCOP Domain Sequences for d1ezvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
ievsk

SCOP Domain Coordinates for d1ezvf_:

Click to download the PDB-style file with coordinates for d1ezvf_.
(The format of our PDB-style files is described here.)

Timeline for d1ezvf_: