Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries) |
Domain d1ezve2: 1ezv E:31-86 [59549] Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_ complexed with fes, hem, sma, uq6 |
PDB Entry: 1ezv (more details), 2.3 Å
SCOPe Domain Sequences for d1ezve2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezve2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata
Timeline for d1ezve2: