Lineage for d1ezve2 (1ezv E:31-86)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025862Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 3025863Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 3025864Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)
  7. 3025865Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries)
  8. 3025869Domain d1ezve2: 1ezv E:31-86 [59549]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_
    complexed with fes, hem, sma, uq6

Details for d1ezve2

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOPe Domain Sequences for d1ezve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezve2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOPe Domain Coordinates for d1ezve2:

Click to download the PDB-style file with coordinates for d1ezve2.
(The format of our PDB-style files is described here.)

Timeline for d1ezve2: