Lineage for d1ezve1 (1ezv E:87-215)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165342Fold b.33: ISP domain [50021] (1 superfamily)
  4. 165343Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 165344Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (5 proteins)
  6. 165356Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 165357Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63741] (2 PDB entries)
  8. 165358Domain d1ezve1: 1ezv E:87-215 [59548]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc1, d1ezvd1, d1ezvd2, d1ezve2, d1ezvf1, d1ezvg1, d1ezvh1, d1ezvi1, d1ezvx_, d1ezvy_

Details for d1ezve1

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezve1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Baker's yeast (Saccharomyces cerevisiae)}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

SCOP Domain Coordinates for d1ezve1:

Click to download the PDB-style file with coordinates for d1ezve1.
(The format of our PDB-style files is described here.)

Timeline for d1ezve1: