Details for d1ezvd2

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1ezvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvd2 f.23.11.1 (D:261-306) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppk

SCOPe Domain Coordinates for d1ezvd2:

Click to download the PDB-style file with coordinates for d1ezvd2.
(The format of our PDB-style files is described here.)

Timeline for d1ezvd2: