Lineage for d1ezvd2 (1ezv D:261-306)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87917Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 87918Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 87919Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64530] (1 PDB entry)
  8. 87921Domain d1ezvd2: 1ezv D:261-306 [59547]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvd1, d1ezve1, d1ezvx_, d1ezvy_

Details for d1ezvd2

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvd2 f.2.1.8 (D:261-306) Cytochrome bc1 transmembrane subunits {Baker's yeast (Saccharomyces cerevisiae)}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppk

SCOP Domain Coordinates for d1ezvd2:

Click to download the PDB-style file with coordinates for d1ezvd2.
(The format of our PDB-style files is described here.)

Timeline for d1ezvd2: