Lineage for d1ezvd1 (1ezv D:62-260)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45251Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 45252Protein Cytochrome bc1 domain [46677] (3 species)
  7. 45253Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (1 PDB entry)
  8. 45254Domain d1ezvd1: 1ezv D:62-260 [59546]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvb1, d1ezvb2, d1ezvc1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf1, d1ezvg1, d1ezvh1, d1ezvi1, d1ezvx_, d1ezvy_

Details for d1ezvd1

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvd1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae)}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

SCOP Domain Coordinates for d1ezvd1:

Click to download the PDB-style file with coordinates for d1ezvd1.
(The format of our PDB-style files is described here.)

Timeline for d1ezvd1: