Lineage for d1ezvb2 (1ezv B:219-368)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86102Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 86103Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 86104Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 86125Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 86126Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (1 PDB entry)
  8. 86128Domain d1ezvb2: 1ezv B:219-368 [59544]
    Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvc1, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf1, d1ezvg1, d1ezvh1, d1ezvi1, d1ezvx_, d1ezvy_

Details for d1ezvb2

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

SCOP Domain Sequences for d1ezvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvb2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae)}
sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk
ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel
nfdavkdfklgkfnyvavgdvsnlpyldel

SCOP Domain Coordinates for d1ezvb2:

Click to download the PDB-style file with coordinates for d1ezvb2.
(The format of our PDB-style files is described here.)

Timeline for d1ezvb2: