Lineage for d1ezva1 (1ezv A:27-239)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049845Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1049846Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1049847Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1049848Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 1049849Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries)
  8. 1049858Domain d1ezva1: 1ezv A:27-239 [59541]
    Other proteins in same PDB: d1ezvb1, d1ezvb2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_
    complexed with fes, hem, sma, uq6

Details for d1ezva1

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
PDB Compounds: (A:) ubiquinol-cytochrome c reductase complex core protein I

SCOPe Domain Sequences for d1ezva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezva1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aevtqlsngivvatehnpahtasvgvvfgsgaanenpynngvsnlwkniflskensavaa
keglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlkq
vqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsnav
vvgtgnikhedlvnsiesknlslqtgtkpvlkk

SCOPe Domain Coordinates for d1ezva1:

Click to download the PDB-style file with coordinates for d1ezva1.
(The format of our PDB-style files is described here.)

Timeline for d1ezva1: