Lineage for d1ezoa_ (1ezo A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321832Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 321833Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 321834Family c.94.1.1: Phosphate binding protein-like [53851] (21 proteins)
  6. 321847Protein D-maltodextrin-binding protein, MBP [53862] (3 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 321852Species Escherichia coli [TaxId:562] [53863] (30 PDB entries)
  8. 321880Domain d1ezoa_: 1ezo A: [59539]
    mutant

Details for d1ezoa_

PDB Entry: 1ezo (more details)

PDB Description: global fold of maltodextrin binding protein complexed with beta- cyclodextrin

SCOP Domain Sequences for d1ezoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezoa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli}
kteegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOP Domain Coordinates for d1ezoa_:

Click to download the PDB-style file with coordinates for d1ezoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ezoa_: