Lineage for d1ex8a_ (1ex8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561802Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
    automatically mapped to Pfam PF01288
  5. 2561803Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (2 proteins)
  6. 2561804Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)
  7. 2561810Species Escherichia coli [TaxId:562] [55086] (42 PDB entries)
    Uniprot P26281
  8. 2561847Domain d1ex8a_: 1ex8 A: [59538]
    complexed with a4p, cl, mg

Details for d1ex8a_

PDB Entry: 1ex8 (more details), 1.85 Å

PDB Description: crystal structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with hp4a, the two-substrate-mimicking inhibitor
PDB Compounds: (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase

SCOPe Domain Sequences for d1ex8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex8a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOPe Domain Coordinates for d1ex8a_:

Click to download the PDB-style file with coordinates for d1ex8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ex8a_: