![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) ![]() |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins) |
![]() | Protein Guanylate kinase [52542] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52543] (3 PDB entries) |
![]() | Domain d1ex6a_: 1ex6 A: [59535] |
PDB Entry: 1ex6 (more details), 2.3 Å
SCOP Domain Sequences for d1ex6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ex6a_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae)} srpivisgpsgtgkstllkklfaeypdsfgfsvssttrtpragevngkdynfvsvdefks miknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelnarflfi appsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivnddldkaykelkd fifaek
Timeline for d1ex6a_: