Lineage for d1ewjh_ (1ewj H:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132421Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 132422Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 132451Family d.32.1.2: Bleomycin resistance protein, BRP [54598] (1 protein)
  6. 132452Protein Bleomycin resistance protein, BRP [54599] (3 species)
  7. 132453Species Klebsiella pneumoniae [TaxId:573] [64256] (2 PDB entries)
  8. 132463Domain d1ewjh_: 1ewj H: [59533]

Details for d1ewjh_

PDB Entry: 1ewj (more details), 2.5 Å

PDB Description: crystal structure of bleomycin-binding protein complexed with bleomycin

SCOP Domain Sequences for d1ewjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewjh_ d.32.1.2 (H:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne

SCOP Domain Coordinates for d1ewjh_:

Click to download the PDB-style file with coordinates for d1ewjh_.
(The format of our PDB-style files is described here.)

Timeline for d1ewjh_: