Lineage for d1ewjg_ (1ewj G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549490Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2549491Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 2549492Species Klebsiella pneumoniae [TaxId:573] [64256] (4 PDB entries)
    the transposon tn5-encoding bleomycin-binding protein, BlmT
  8. 2549501Domain d1ewjg_: 1ewj G: [59532]
    complexed with blm

Details for d1ewjg_

PDB Entry: 1ewj (more details), 2.5 Å

PDB Description: crystal structure of bleomycin-binding protein complexed with bleomycin
PDB Compounds: (G:) bleomycin resistance determinant

SCOPe Domain Sequences for d1ewjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewjg_ d.32.1.2 (G:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne

SCOPe Domain Coordinates for d1ewjg_:

Click to download the PDB-style file with coordinates for d1ewjg_.
(The format of our PDB-style files is described here.)

Timeline for d1ewjg_: