| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
| Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
| Protein Bleomycin resistance protein, BRP [54599] (3 species) Active as dimer |
| Species Klebsiella pneumoniae [TaxId:573] [64256] (4 PDB entries) the transposon tn5-encoding bleomycin-binding protein, BlmT |
| Domain d1ewjg_: 1ewj G: [59532] complexed with blm |
PDB Entry: 1ewj (more details), 2.5 Å
SCOPe Domain Sequences for d1ewjg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewjg_ d.32.1.2 (G:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
Timeline for d1ewjg_: