Lineage for d1ewje_ (1ewj E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2186724Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2186725Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 2186726Species Klebsiella pneumoniae [TaxId:573] [64256] (4 PDB entries)
    the transposon tn5-encoding bleomycin-binding protein, BlmT
  8. 2186733Domain d1ewje_: 1ewj E: [59530]
    complexed with blm

Details for d1ewje_

PDB Entry: 1ewj (more details), 2.5 Å

PDB Description: crystal structure of bleomycin-binding protein complexed with bleomycin
PDB Compounds: (E:) bleomycin resistance determinant

SCOPe Domain Sequences for d1ewje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewje_ d.32.1.2 (E:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne

SCOPe Domain Coordinates for d1ewje_:

Click to download the PDB-style file with coordinates for d1ewje_.
(The format of our PDB-style files is described here.)

Timeline for d1ewje_: