Lineage for d1ewjc_ (1ewj C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79199Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 79200Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 79229Family d.32.1.2: Bleomycin resistance protein, BRP [54598] (1 protein)
  6. 79230Protein Bleomycin resistance protein, BRP [54599] (3 species)
  7. 79231Species Klebsiella pneumoniae [TaxId:573] [64256] (2 PDB entries)
  8. 79236Domain d1ewjc_: 1ewj C: [59528]

Details for d1ewjc_

PDB Entry: 1ewj (more details), 2.5 Å

PDB Description: crystal structure of bleomycin-binding protein complexed with bleomycin

SCOP Domain Sequences for d1ewjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewjc_ d.32.1.2 (C:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne

SCOP Domain Coordinates for d1ewjc_:

Click to download the PDB-style file with coordinates for d1ewjc_.
(The format of our PDB-style files is described here.)

Timeline for d1ewjc_: