Lineage for d1ew2a_ (1ew2 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74262Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
  4. 74263Superfamily c.76.1: Alkaline phosphatase-like [53649] (3 families) (S)
  5. 74264Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
  6. 74265Protein Alkaline phosphatase [53651] (2 species)
  7. 74309Species Human (Homo sapiens) [TaxId:9606] [64165] (1 PDB entry)
  8. 74310Domain d1ew2a_: 1ew2 A: [59525]

Details for d1ew2a_

PDB Entry: 1ew2 (more details), 1.82 Å

PDB Description: crystal structure of a human phosphatase

SCOP Domain Sequences for d1ew2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ew2a_ c.76.1.1 (A:) Alkaline phosphatase {Human (Homo sapiens)}
iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlapp

SCOP Domain Coordinates for d1ew2a_:

Click to download the PDB-style file with coordinates for d1ew2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ew2a_: