Lineage for d1ew2a_ (1ew2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138455Family c.76.1.1: Alkaline phosphatase [53650] (2 protein domains)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2138456Protein Alkaline phosphatase [53651] (4 species)
  7. 2138549Species Human (Homo sapiens) [TaxId:9606] [64165] (1 PDB entry)
  8. 2138550Domain d1ew2a_: 1ew2 A: [59525]
    complexed with mg, nag, po4, zn

Details for d1ew2a_

PDB Entry: 1ew2 (more details), 1.82 Å

PDB Description: crystal structure of a human phosphatase
PDB Compounds: (A:) phosphatase

SCOPe Domain Sequences for d1ew2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ew2a_ c.76.1.1 (A:) Alkaline phosphatase {Human (Homo sapiens) [TaxId: 9606]}
iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlapp

SCOPe Domain Coordinates for d1ew2a_:

Click to download the PDB-style file with coordinates for d1ew2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ew2a_: