| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
| Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
| Protein Glutamate dehydrogenase [53225] (8 species) |
| Species Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry) |
| Domain d1euzf2: 1euz F:3-180 [59524] Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1 complexed with so4 |
PDB Entry: 1euz (more details), 2.25 Å
SCOPe Domain Sequences for d1euzf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euzf2 c.58.1.1 (F:3-180) Glutamate dehydrogenase {Thermococcus profundus [TaxId: 49899]}
eidpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhn
wargptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqer
larayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls
Timeline for d1euzf2: