SCOP 1.57: Domain d1euzf2: 1euz F:3-180

Lineage for d1euzf2 (1euz F:3-180)

Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
Protein Glutamate dehydrogenase [53225] (6 species)
Species Archaeon Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry)
Domain d1euzf2: 1euz F:3-180 [59524]
Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1

Details for d1euzf2

PDB Entry: 1euz (more details), 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state

SCOP Domain Sequences for d1euzf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euzf2 c.58.1.1 (F:3-180) Glutamate dehydrogenase {Archaeon Thermococcus profundus}
eidpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhn
wargptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqer
larayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls

SCOP Domain Coordinates for d1euzf2:

Click to download the PDB-style file with coordinates for d1euzf2.
(The format of our PDB-style files is described here.)

Timeline for d1euzf2: