Lineage for d1euzf1 (1euz F:181-419)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349489Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1349490Protein Glutamate dehydrogenase [51884] (8 species)
  7. 1349578Species Thermococcus profundus [TaxId:49899] [63943] (1 PDB entry)
  8. 1349584Domain d1euzf1: 1euz F:181-419 [59523]
    Other proteins in same PDB: d1euza2, d1euzb2, d1euzc2, d1euzd2, d1euze2, d1euzf2
    complexed with so4

Details for d1euzf1

PDB Entry: 1euz (more details), 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state
PDB Compounds: (F:) glutamate dehydrogenase

SCOPe Domain Sequences for d1euzf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euzf1 c.2.1.7 (F:181-419) Glutamate dehydrogenase {Thermococcus profundus [TaxId: 49899]}
iggslgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvv
avsdsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieev
iteknadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqnin
gyywteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk

SCOPe Domain Coordinates for d1euzf1:

Click to download the PDB-style file with coordinates for d1euzf1.
(The format of our PDB-style files is described here.)

Timeline for d1euzf1: