SCOPe 2.05: Domain d1euze2: 1euz E:4-180

Lineage for d1euze2 (1euz E:4-180)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (8 species)

7. Species Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry)

8. Domain d1euze2: 1euz E:4-180 [59522]
   Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1
   complexed with so4

Details for d1euze2

PDB Entry: 1euz, 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state

PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d1euze2:

Sequence; same for both SEQRES and ATOM records:

>d1euze2 c.58.1.1 (E:4-180) Glutamate dehydrogenase {Thermococcus profundus [TaxId: 49899]}
idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls

Timeline for d1euze2:

• d1euze2 first appeared in SCOP 1.57
  
• d1euze2 appears in SCOPe 2.04
  
• d1euze2 appears in SCOPe 2.06
  
• d1euze2 appears in the current release, SCOPe 2.08