![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Glutamate dehydrogenase [51884] (7 species) |
![]() | Species Archaeon Thermococcus profundus [TaxId:49899] [63943] (1 PDB entry) |
![]() | Domain d1euze1: 1euz E:181-419 [59521] Other proteins in same PDB: d1euza2, d1euzb2, d1euzc2, d1euzd2, d1euze2, d1euzf2 |
PDB Entry: 1euz (more details), 2.25 Å
SCOP Domain Sequences for d1euze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euze1 c.2.1.7 (E:181-419) Glutamate dehydrogenase {Archaeon Thermococcus profundus} iggslgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvv avsdsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieev iteknadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqnin gyywteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk
Timeline for d1euze1: