Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Glutamate dehydrogenase [51884] (8 species) |
Species Thermococcus profundus [TaxId:49899] [63943] (1 PDB entry) |
Domain d1euze1: 1euz E:181-419 [59521] Other proteins in same PDB: d1euza2, d1euzb2, d1euzc2, d1euzd2, d1euze2, d1euzf2 complexed with so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1euz (more details), 2.25 Å
SCOPe Domain Sequences for d1euze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euze1 c.2.1.7 (E:181-419) Glutamate dehydrogenase {Thermococcus profundus [TaxId: 49899]} iggslgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvv avsdsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieev iteknadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqnin gyywteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk
Timeline for d1euze1: