SCOP 1.65: Domain d1euzd2: 1euz D:4-180

Lineage for d1euzd2 (1euz D:4-180)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
Protein Glutamate dehydrogenase [53225] (7 species)
Species Archaeon Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry)
Domain d1euzd2: 1euz D:4-180 [59520]
Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1

Details for d1euzd2

PDB Entry: 1euz (more details), 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state

SCOP Domain Sequences for d1euzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euzd2 c.58.1.1 (D:4-180) Glutamate dehydrogenase {Archaeon Thermococcus profundus}
idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls

SCOP Domain Coordinates for d1euzd2:

Click to download the PDB-style file with coordinates for d1euzd2.
(The format of our PDB-style files is described here.)

Timeline for d1euzd2: