Lineage for d1euzc2 (1euz C:4-180)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143051Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2143052Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2143053Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2143054Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2143151Species Thermococcus profundus [TaxId:49899] [64106] (1 PDB entry)
  8. 2143154Domain d1euzc2: 1euz C:4-180 [59518]
    Other proteins in same PDB: d1euza1, d1euzb1, d1euzc1, d1euzd1, d1euze1, d1euzf1
    complexed with so4

Details for d1euzc2

PDB Entry: 1euz (more details), 2.25 Å

PDB Description: glutamate dehydrogenase from thermococcus profundus in the unligated state
PDB Compounds: (C:) glutamate dehydrogenase

SCOPe Domain Sequences for d1euzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euzc2 c.58.1.1 (C:4-180) Glutamate dehydrogenase {Thermococcus profundus [TaxId: 49899]}
idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkpls

SCOPe Domain Coordinates for d1euzc2:

Click to download the PDB-style file with coordinates for d1euzc2.
(The format of our PDB-style files is described here.)

Timeline for d1euzc2: