Lineage for d1eufa_ (1euf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795355Protein Duodenase [63791] (1 species)
    new serine protease
  7. 2795356Species Cow (Bos taurus) [TaxId:9913] [63792] (1 PDB entry)
  8. 2795357Domain d1eufa_: 1euf A: [59506]
    complexed with nag, po4

Details for d1eufa_

PDB Entry: 1euf (more details), 2.4 Å

PDB Description: bovine duodenase(new serine protease), crystal structure
PDB Compounds: (A:) duodenase

SCOPe Domain Sequences for d1eufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]}
iiggheakphsrpymafllfktsgkshicggflvredfvltaahclgssinvtlgahnim
erertqqvipvrrpiphpdyndetlandimllkltrkaditdkvspinlprslaevkpgm
mcsvagwgrlgvnmpstdklqevdlevqseekciarfknyipftqicagdpskrknsfsg
dsggplvcngvaqgivsygrndgttpdvytrissflswihstmr

SCOPe Domain Coordinates for d1eufa_:

Click to download the PDB-style file with coordinates for d1eufa_.
(The format of our PDB-style files is described here.)

Timeline for d1eufa_: