![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Amylomaltase MalQ [51478] (3 species) 4-alpha-glucanotransferase; single-domain amylase with several insertions in the common fold |
![]() | Species Thermus aquaticus [TaxId:271] [51479] (4 PDB entries) synonym: Thermus thermophilus |
![]() | Domain d1eswa_: 1esw A: [59500] complexed with acr, edo |
PDB Entry: 1esw (more details), 1.9 Å
SCOP Domain Sequences for d1eswa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} melprafglllhptslpgpygvgvlgreardflrflkeaggrywqvlplgptgygdspyq sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrgfea yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg mkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmarylad wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg elspehgarlramaeaterl
Timeline for d1eswa_: