Lineage for d1eswa_ (1esw A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682170Protein Amylomaltase MalQ [51478] (3 species)
    4-alpha-glucanotransferase; single-domain amylase with several insertions in the common fold
  7. 682176Species Thermus aquaticus [TaxId:271] [51479] (4 PDB entries)
    synonym: Thermus thermophilus
  8. 682177Domain d1eswa_: 1esw A: [59500]
    complexed with acr, edo

Details for d1eswa_

PDB Entry: 1esw (more details), 1.9 Å

PDB Description: x-ray structure of acarbose bound to amylomaltase from thermus aquaticus. implications for the synthesis of large cyclic glucans
PDB Compounds: (A:) amylomaltase

SCOP Domain Sequences for d1eswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]}
melprafglllhptslpgpygvgvlgreardflrflkeaggrywqvlplgptgygdspyq
sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrgfea
yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
mkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmarylad
wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
elspehgarlramaeaterl

SCOP Domain Coordinates for d1eswa_:

Click to download the PDB-style file with coordinates for d1eswa_.
(The format of our PDB-style files is described here.)

Timeline for d1eswa_: