SCOP 1.57: Domain d1eqja1: 1eqj A:77-310

Lineage for d1eqja1 (1eqj A:77-310)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.105: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64157] (1 superfamily)

4. Superfamily c.105.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64158] (1 family)

5. Family c.105.1.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64159] (1 protein)

6. Protein 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64160] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [64161] (2 PDB entries)

8. Domain d1eqja1: 1eqj A:77-310 [59495]
   Other proteins in same PDB: d1eqja2

Details for d1eqja1

PDB Entry: 1eqj, 1.7 Å

PDB Description: crystal structure of phosphoglycerate mutase from bacillus stearothermophilus complexed with 2-phosphoglycerate

SCOP Domain Sequences for d1eqja1:

Sequence; same for both SEQRES and ATOM records:

>d1eqja1 c.105.1.1 (A:77-310) 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain {Bacillus stearothermophilus}
qsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdggvhshihhlyallrla
akegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeiatlsgryysmdrdkrwd
rvekayramvygegptyrdpleciedsykhgiydefvlpsvivredgrpvatiqdndaii
fynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfsetvagyvafkp

Timeline for d1eqja1:

• d1eqja1 is new in SCOP 1.57
  
• d1eqja1 appears in SCOP 1.59
  
• d1eqja1 appears in the current release, SCOPe 2.08