![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.105: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64157] (1 superfamily) core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 45321678, strands 4 and 5 are antiparallel to the rest |
![]() | Superfamily c.105.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64158] (1 family) ![]() automatically mapped to Pfam PF06415 |
![]() | Family c.105.1.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64159] (1 protein) |
![]() | Protein 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64160] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [64161] (4 PDB entries) |
![]() | Domain d1eqja1: 1eqj A:77-310 [59495] Other proteins in same PDB: d1eqja2 complexed with 2pg, mn |
PDB Entry: 1eqj (more details), 1.7 Å
SCOPe Domain Sequences for d1eqja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqja1 c.105.1.1 (A:77-310) 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain {Bacillus stearothermophilus [TaxId: 1422]} qsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdggvhshihhlyallrla akegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeiatlsgryysmdrdkrwd rvekayramvygegptyrdpleciedsykhgiydefvlpsvivredgrpvatiqdndaii fynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfsetvagyvafkp
Timeline for d1eqja1: