Lineage for d1eqja1 (1eqj A:77-310)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148423Fold c.105: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64157] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 45321678, strands 4 and 5 are antiparallel to the rest
  4. 2148424Superfamily c.105.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64158] (1 family) (S)
    automatically mapped to Pfam PF06415
  5. 2148425Family c.105.1.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64159] (1 protein)
  6. 2148426Protein 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64160] (1 species)
  7. 2148427Species Bacillus stearothermophilus [TaxId:1422] [64161] (4 PDB entries)
  8. 2148429Domain d1eqja1: 1eqj A:77-310 [59495]
    Other proteins in same PDB: d1eqja2
    complexed with 2pg, mn

Details for d1eqja1

PDB Entry: 1eqj (more details), 1.7 Å

PDB Description: crystal structure of phosphoglycerate mutase from bacillus stearothermophilus complexed with 2-phosphoglycerate
PDB Compounds: (A:) phosphoglycerate mutase

SCOPe Domain Sequences for d1eqja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqja1 c.105.1.1 (A:77-310) 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain {Bacillus stearothermophilus [TaxId: 1422]}
qsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdggvhshihhlyallrla
akegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeiatlsgryysmdrdkrwd
rvekayramvygegptyrdpleciedsykhgiydefvlpsvivredgrpvatiqdndaii
fynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfsetvagyvafkp

SCOPe Domain Coordinates for d1eqja1:

Click to download the PDB-style file with coordinates for d1eqja1.
(The format of our PDB-style files is described here.)

Timeline for d1eqja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eqja2